Ranking Alexa Global: # 4,771,775
The main IP address: maxwelldrive.dishley,Your server United Kingdom,Uxbridge ISP:Rackspace Ltd. TLD:uk CountryCode:uk
This report updates in 12-Jul-2017
Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service found where is host maxwelldrive.dishleygrangemedicalpractice.co.uk. Currently, hosted in United Kingdom and its service provider is Rackspace Ltd. .
Latitude: | 51.546188354492 |
Longitude: | -0.4796099960804 |
Country: | United Kingdom (uk) |
City: | Uxbridge |
Region: | England |
ISP: | Rackspace Ltd. |
HTTP Header information is a part of HTTP protocol that a user's browser sends to called containing the details of what the browser wants and will accept back from the web server.
Whois is a protocol that is access to registering information. You can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations. In a nutshell, it includes these informations;
Error for "dishleygrangemedicalpractice.co.uk".
the WHOIS query quota for 2600:3c03:0000:0000:f03c:91ff:feae:779d has been exceeded
and will be replenished in 228 seconds
WHOIS lookup made at 00:08:39 30-Aug-2017
--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:
Copyright Nominet UK 1996 - 2017.
You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.
REFERRER http://www.nominet.org.uk
REGISTRAR Nominet UK
SERVERS
SERVER co.uk.whois-servers.net
ARGS dishleygrangemedicalpractice.co.uk
PORT 43
TYPE domain
DISCLAIMER
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:
Copyright Nominet UK 1996 - 2017.
You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.
REGISTERED no
DOMAIN
NAME dishleygrangemedicalpractice.co.uk
NSERVER
NS2.RACKSPACE.COM 65.61.188.4
NS.RACKSPACE.COM 69.20.95.4
The following list shows you to spelling mistakes possible of the internet users for the website searched .